TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D1GUL7|D1GUL7_STAA0 Putative transporter protein OS=Staphylococcus aureus (strain TW20 / 0582) GN=norC PE=4 SV=1
MNETYRGGNKLILGIVLGVITFWLFAQSLVNVVPNLQQSFGADMGTISIAVSLTALFSGMFVVGAGGLADKIGRVKMTNI
GLLLSIIGSALIIITNLPALLILGRIIQGVSAACIMPSTLAIMKTYYEGAERQRALSYWSIGSWGGSGICSLFGGAVATT
MGWRWIFIFSIIVAVLSMLLIKGTPETKSEVTNTHKFDVAGLIVLVVMLLSLNVVITKGAALGYTSLWFFGLIAIVIVAF
FIFLNVEKKVDNPLIDFKLFENKPYTGATISNFLLNGVAGTLIVANTFVQQGLGYTALQAGYLSITYLIMVLLMIRVGEK
LLQKMGSKRPMLLGTFIVIIGIALISLVFLPGIFYVISCVVGYLCFGLGLGIYATPSTDTAISNAPLDKVGVASGIYKMA
SSLGGAFGVAISGAVYAGAVAATSIHTGAMIALWVNVLMGIMAFIAILFAIPNDDKRVKDAK