TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D2KWR3|D2KWR3_OSTNU Odorant receptor (Fragment) OS=Ostrinia nubilalis GN=OnubOR5a PE=2 SV=1
PLALKYFKSIRTVMVAPGVWPAEIFGEKISVVAIVHRVTLPYHTSLIVFGELYYIWMHMHELSFLDLGHMIITTLLGILT
AVRSILPQLQNYHKLLLKFINVMHLMHSTNKGPYYNQMNDTVDKVCSYYTKFSLGLIFISCSMFNVAPFCNNIANVFIFK
TENYTLEFSLYYQFPGIDPTDYFTTTSIYNFYLSYNCAMMVSGLDLILFLIIFQIIGHVYILRYNLENFPWPKNKVVFKL
GDILKYKINESITSEMFDAEENKEVRFKLAECIEYHKKIIGFTDEVSALFGPILACNYLFHLVCCSLLLLECSEGGYSAM
LRYGPMTVLIYGQLIQMSVIFELLGSETEKLPDSAYFLPWECMDTSNRRTACIMLHKMQYKISLKALGLAAVGVSTMTGI
LKTTFSYYAFLQTMGD