TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D2N2E0|D2N2E0_NEUCS Pheromone receptor 2 OS=Neurospora crassa GN=pre2 PE=4 SV=1
MASSSSSPADIFSGITQSLNSTHATLTLPIPPADRDHLENQVLFLFDNHGQLLNVTTTYIDAFNNMLVSTTINYATQIGA
TFIMLAIMLLMTPRRRFKRLPTIISLLALCINLIRVVLLALFFPSHWTDFYVLYSGDWQFVPPGDMQISVAATVLSIPVT
ALLLSALMVQAWSMMQLWTPLWRALVVLVSGLLSLATVAMSFANCIFQAKNILYADPLPSYWVRKLYLALTTGSISWFTF
LFMIRLVMHMWTNRSILPSMKGLKAMDVLIITNSILMLIPVLFAGLEFLDSASGFESGSLTQTSVVIVLPLGTLVAQRIA
TRGYMPDSLEASSGPNGSLPLSNLSFAGGGGGGSGGHKDKENGGGIIPPTTNNTAATNFSSSIACSGISCLPKVKRMTAS
SASSSQRPLLTMTNSTIASNDSSGFPSPGIHNTTTTTTQYQYSMGMNMPNFPPVPFPGYQSRTTGVTSHIVSDGRHHQGM
NRHPSVDHFDRELARIDDEDDDGYPFASSEKAVMHGDDDDDVERKRRRALPPSLGGVRVERTIETRSEERMPSPDPLGVT
KPRSFE