TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D3B7R7|D3B7R7_POLPP Probable membrane protein OS=Polysphondylium pallidum (strain ATCC 26659 / Pp 5 / PN500) GN=PPL_04505 PE=4 SV=1
MKSPTGKNSGGKRALFIEKVSGIQEMTFGENFKNILPTFNTEDWWSTLIGLVFRAYHVVVNLIKRKGYQSIQESPMDEWM
TSTDSGSSTSLAPPKKVESIWTEDCTPEWLKCVLVDEYFIKLDRDYAIVSAGAVSICGSSAANAIGSTIGASKSAISFPI
AIMALWTIPCITLMPVMFTKWLEDTMKWSSRQGGAWIGGTIDTTGAVVASAAIIDEEAKQSAAIVKMLQNCLIGPICLIV
LITNLLVNKDKESDLSFKKVLKILFDRFPKFVLGFFIVCAILTTLPTSDWKSHVISTSLLASAWFETMGFVCIGLNIRIT
EIYNNLGVMKLILFYLLAQCLDMFTTGLLATYAFS