TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D3DK25|D3DK25_HYDTT Uncharacterized protein OS=Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6) GN=HTH_1732 PE=4 SV=1
MGIKEFMLFLHIIFASFWVGGMIFLVLVLSPFVRKLPIRDQAFQEVGRRFSFYGTLLTLLGLFITGLFNIHYILGFPNLF
NFSNQYTLTLWHKIGLFLIVVVVSLVHDLYFGKRALESGFYRIMARILGFVNLILGLAIVYFAVVLRFGG