TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D3P9M1|D3P9M1_DEFDS Uncharacterized protein OS=Deferribacter desulfuricans (strain DSM 14783 / JCM 11476 / NBRC 101012 / SSM1) GN=DEFDS_1960 PE=4 SV=1
MNKYLVMLLLAVAGTFVSLQASINAKLAKYVGFLESAFVSFFVGTITLLIFLFFKGFSGFKHIGEVPPIYLTGGILGAFF
VFVITYSVPKIGVSAALSITIAVQLILGLLLDKFNPFAINSFEVSIYNILGVVLTIIGVIMLTYNR