TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D4GP36|D4GP36_HALVD ABC-type transport system permease protein (Probable substrate sugar) OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) OX=309800 GN=tsgB7 PE=3 SV=1
MATHDNTEHVSDATDEAVGWESKLRYFLNSDFVRSAPYWGIPFVLMSIAVYGGTGYNFAISFTDYEGLGTPDYSTLDLEM
YAQALSSDAFIAAAQNNLVLLVGFTTICLVLGLFLAILLDHGIRFSEKFQTVYLLPMSLSFVVTAQLWLWMFNVESGILN
LVVTTLGFNPVDWLGNPSIALGAVILALIWQFSGYTMVVYLAGLQSIPDDQFEAARVDGASITRTYLRIIVPQLKEASVS
AAVVLMVFALKAFTFLYALVGRYRPPNGTDILATLMVRRAFKFGEWAYSAAIATMLLIMALGVIGPYLYYQYKQGGL