TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D5BZQ5|D5BZQ5_NITHN Uncharacterized protein OS=Nitrosococcus halophilus (strain Nc4) GN=Nhal_1188 PE=4 SV=1
MNLFQELRFLLDISRSHRIARRYFVTNGFDGALAMLGLTMGFYITDAVAVSTVLNACMGTAIALMMSGLLSAYISEAAER
QKELHELEQAMVTNLAHSAHGKAARLIPLLIALVNGGSPFFIALLIISPLWLNQYGVVLPLGPLETSIAVAFGIIFLLGV
FLGKISGTFWLWTGLRTLAIAVITGLLILLLQAG