TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D5EHS6|D5EHS6_CORAD Nucleoside-specific channel-forming protein, Tsx-like protein OS=Coraliomargarita akajimensis (strain DSM 45221 / IAM 15411 / JCM 23193 / KCTC 12865) GN=Caka_1096 PE=4 SV=1
MNNILKHGISIAILGAGLLSVGELAAEQKPSAGILLWQDTSLSYLLGEQFKVDPARQQTLTLEHAAGWSFGDSFFFFDFI
DYRDNDWGDNSYYGEFSPRFSVNKLTDAGIAFGPVRDLLLATTLEFGEGDTETFLFGPGLDLNLPGFDYFQLNLYYREGL
NNKSNGWQLTPVWSITLPIGKSEIVFDGFIDYVFATQSAGYSNNLHICPQLKYNLGKAIWGEQQRLYLGVEFDYWTNKYG
IKSSPAFKTDQFAYSFLVKYHL