TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D5ESR8|D5ESR8_PRER2 Putative uncharacterized protein OS=Prevotella ruminicola (strain ATCC 19189 / JCM 8958 / 23) GN=PRU_1359 PE=4 SV=1
MYRRLSTLIVALLALAHVSAQTDRDFNQIDENGNVSRRSENFNKHSKDTTQHKEIPKGLYTWTIDRRFGDVIPTEPDTLS
HLFMNTTFNSGMYGDYNTTGSNYTARLSRIFIDRPYGDYFIFTEPYSFVNKKPDELLYMNTLSPYTSVLYDNCGDKTNGE
DHIDAKFAVNANKRLNFGFDLDYAYARGYYSNQNVSHFNGTLFGSYLGDRYQMHFFFNAAHQKASENGGITTDDYVTHPE
SFTDNYTESEIPTVLSKNWNRNDHQHLFLSHRYNIGFYRMVKMTDEEIKARQFAKESMKEHEAEKEQQDADKKELRKEKD
TKKPTGRPEGAKVVGKEPQRDALDIAADTTRIKVDGQAAIDSLNRLQAIQDSIDATMKREYVPVTSFIHTLDISNYNHIY
QAYSTPTNYYQNTYYKQGLVYGNDSIYDQVKHQHIKNTLALALLEGFNKYVKAGLKAFVSYEHNTYQMPELENGLLLWNK
WKEYNLTFGAQLSKTQGKTLHFNLTAERWLSGADAGDMTIDFSTDLNFPLFGDTVQLAASAFYQQCNPVFLQATYHSKHI
WWDNNFDREKRSRIEGLFSYQKTNTKLRIAAENIKNYTYYGMSYDLTDNGGRKNMTAGVYQEGENIQILTAQLHQNFRLG
PLNWENVITYQKSSNKEVLPLPDLNIFTNLYLKFKIAKVLGVELGADATYFTKYYAPDFCPAINQFAVQKNEASRIELGE
FPFIDVYANMTLKGVRFFLVMTNVVNNGANHMKFLTPHYPTNGSVIHFGVSWPFFN