TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D5UKP2|D5UKP2_CELFN Uncharacterized protein OS=Cellulomonas flavigena (strain ATCC 482 / DSM 20109 / NCIB 8073 / NRS 134) GN=Cfla_0953 PE=4 SV=1
MTVLATRTRATTGAALLLPRRRARQDAGLLLGTALLLAGALLALLAAPRLLDRTADEALRTAVAHAGADAGVTLRGASPS
DAAPPGAPFDELVQQARWIDAEVDLMLPATAVGRSAPYRTVLDGRSAFADGGPDGVVLATRLVTVSTPSDPADPVRWVAG
RVPEAADPGTPEDPRPPTVQVGLHVDAARELGVDPTLAPVRLRIGTRTSYQTVDVTGLYEAVDPQDPHWARVPELLGPVA
TPTSEETPLLVGLYVVPDAVSDMARVMGTGRLPGSALALPDVDRITTADVPSLRRDVVSFLTTEKGASSGLPAVLDAFAA
HLGAARAQAALVLAGLGATAACCLVLAAALLVERRRTHLAGERARGASLASVALRGAVESLPLAALAAAVAWTAVTVWLP
RAAAGTWLPVTVTLVAAAAPAVLAARAAGAAWAGRRVPADRRERARLAGLQAARRLLVELVAVAVAVLALVSLRGRGLVP
ATGASADPLLTSTPFLLAVAASFAVVRVAPAVVRAVGRWTTRTRGLAGPLAATRAQRAATSLLPLVSVTVAVALMVLCGV
LVQNVRDGQQVAADRLVGADVRVDGALESDRAAAALDALRAAPGVTAVATGAQLTERTIGRDLDLAATVLVVDAPELARV
RQAVGLPVDPRLDALRVPGGLGPDDLVPVLVDPDLLPRLGRTQDLLLQVYTRHVDTEVVGTTALTPDSGAPPVDARAAGA
SVTGDDGVAVVDAATLAPVAEKMPPVTRAWVAGPGAAQAVADAGLADLPGVTVTTRDGWYEQWSRAPIPGALTALLLAAV
GALALLAVVALALVVVATSGERGRTLSTLRTLGLDARTARWATLGELAPLVVGGLLGGAVIGLALPVLVGDALGLAWVTA
APGSVPVEPVLWPVLLAAATLAVALLVAVLVEQAVRRREDLGEVLRVGAR