TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D5UX71|D5UX71_TSUPD Copper resistance D domain-containing protein OS=Tsukamurella paurometabola (strain ATCC 8368 / DSM 20162 / JCM 10117 / NBRC 16120 / NCTC 13040) GN=Tpau_3511 PE=4 SV=1
MAPARPFAVVIVAAGFRAAADLSGMLLLGVLVLRAFAGLPDGRSRSAGPMPRLAAAWAVCAALNLVATAADRTGAPLWRV
DLAGLVAEIRAVPATAVTIAVAVLLGVLGSRLPAGAAVGAAAIGLAAGPATGHLGLSAVGAAVVTVHVLTAAWWFGGLAA
MPIVLRGRDEWARALGEFGRWAPAAVALLGISGGAAAVIRHPAAGSAAFVLVVVKAGALAALLAVGLWQRRVTTVRAGTT
PVRRTRRSIGTEAGALATVTVAAAALSYAA