TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D6TT54|D6TT54_9CHLR ABC transporter related protein OS=Ktedonobacter racemifer DSM 44963 GN=Krac_4592 PE=3 SV=1
MNIEINHLTKIYRGNVQALSDLSLVIPQGMFGLVGPNGAGKTTLMRILVGILHPTSGTVQIGQYDGTREQGRAAIKRILG
YVPQELGMYPDLSAREFLDYVGVLKGLKDRKPRRLRVEQLLETVALSTVAWRKVKTFSGGMKRRLGIAQALINDPQILIV
DEPTAGLDPEERIRFRNLLSDLGSNRTVLLSTHIVEDIAQTCQNIAVMKSGQVLFQGTVAQMLEATREKVWLLTTPGPRP
EGNFTIVSALNMGANVQYRVVGDLSPRVGAVPTEPGLEDGYVWLMHTDPRQSTEAHASSI