TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D6TT55|D6TT55_9CHLR Uncharacterized protein OS=Ktedonobacter racemifer DSM 44963 GN=Krac_4593 PE=4 SV=1
MNALSVTGGALRYEFLMQIRRRSLWVVLVIVSVLGFSLWVSLLSAHPVSSPHVISTPQETAHDLVLYLAQFAAWFLPLGA
GLVVADRLARDKKLHVDEILDTFPGGLFARLLGKYLGSTLATLVPVLLIYLLGVGYVLAKFHDPQSLLLALEAFAAILLP
GIVFAAGFSIALPVLLKVPLYQILFIGYWFWANLMSPRFPIPSPVATMLNATGPWAQEAFFHFQWVFLILHPTIWQGVES
IALLVGLGGLSVFAAWLYLRWEQAHR