TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D7F949|D7F949_DROME Odorant receptor 85b (Fragment) OS=Drosophila melanogaster GN=or85b PE=3 SV=1
SNVINLSFVGLFESIYVYSAFMDNKFLEAVTALSYIGFVTVGMSKMFFIRWKKTAITELINELKEIYPNGLIREERYNLP
MYLGTCSRISLIYSLLYSVLIWTFNLFCVMEYWVYDKWLNIRVVGKQLPYLMYIPWKWQDNWSYYPLLFSQNFAGYTSAA
GQISTDVLLCAVATQLVMHFDFLSNSMERHELSGDWKKDSRFLVDIVRYHERILRLSDAVNDIFGIPLLLNFMVSSFVIC
FVGVATYNQKWYKADVRYKRALVIIIARSQKVTFLKATIFLDITRSTMTDLLQISYKFFALL