TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D7FE37|D7FE37_HELP3 Iron(III) dicitrate transport protein (FecA) OS=Helicobacter pylori (strain B8) GN=fecA1 PE=3 SV=1
MKRILVFLAVLSHSAHAVKTHNLERVEASGVANDKEAPLSWRSKEVRNYMGSRTVISNKQLTKSANQSIEEALQNVPGVH
IRNSTGIGAVPSISIRGFGAGGPGHSNTGMILVNGIPIYVAPYVEIGTVIFPVTFQSVDRISVTKGGESVRYGPNAFGGV
INIITKGIPTNWESQVSERTTFWGKSENGGFFNQNSKNIDKSLVNNMLFNTYLRTGGMMNKHFGIQAQVNWLKGQGFRYN
SPTNIQNYLLDSLYQINDSNKITAFFQYYSYFLTDPGSLGIAAYNENRFQNNRPNNDKSGRAKRWGAVYQNFFGDTDRVG
GDFTFSYYGHDMSRDFKFDSNYLNVNTNPKLGPVYTDQNYPGFFIFDHLRRYVMNAFEPNLNLVVNTNKVKQTFNVGMRF
MTMDMFIRSDQSTCEKSDIIDGVCHMPPYVLSKKPSNNQEMFNNYTAVWLSDKIELFDSKLVITPGLRYTFLNYNNKEPE
KHDFSVWNITKKRQNEWSPALNIGYKPMENWIWYANYRRSFIPPQHTMLGITRTNYNQIFNEIEVGQRYSYKNLLSFNTN
YFVIFANRYYAGGYSPQPINARSQGVELELYYAPIRGLQFHVAYTYIDARITSNADDIAYYFTGIVNKPFDIKGKRLPYV
SPNQFIFDMMYTYKHTTFGISSYFYSRAYSSMLNQAKSQTVCLPLNPEYTGGLEYGCNSVGLLPLYFVLNVQVSSVLWQS
GRHKITGSLQINNLFNMKYYFRGIGTSPTGREPAPGRSITAYLNYEF