TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D7FWV9|D7FWV9_ECTSI Putative uncharacterized protein OS=Ectocarpus siliculosus GN=Esi_0315_0018 PE=4 SV=1
MSAAVWDAEKGGATAAVAAAAAAEGSAENWEPASQAGIGGGVDSAGGSGYPETKDNGEDAAANLFGNDIPDEDGGTGGDG
PAIVIASIPPAAADGVVGRGGGLGTRGSAAGTAFASGTSTLTKRRNSMAFEIARVERAGKAVLANPEKAKRAWELSRPRF
VEESSVHGPAMGGSGGGGGGREGKTRARLPPGQENRNAVPYGVWSTSWAQMGDFGLDVGMYFVTLAQLVGAVLVYAALCV
VAMVHFSSENYSGQQAGVRADLRGSAVCTASKEVLAFPRDSWDFRDTFDRNDCPLDSKQGYADMAGVLLLFMLLLLLGKA
QEKAAEYTATQIHSAQPYTVKVSSPDPLADDPERWRRLFAQFGHVSYVTVARGNGALLRAMANRRAVGRRLESSTPDVAE
IVEAYRSVDTKEPPTSGAGGWWKAFLRPCGFSRDTKFWARELWDAHRQVEGEIMKGMHDQGLPVVKVFVTFESDLSQARC
LSHMSRGILDAPEEQHMYTNPDGFKTALHVMPASPASEVLYENLHIGAIHRIAAQVLTFVLTTMIVIISFLAARELEAIG
VVATALVITVVDVVLPPLVRLICSVEKHHNSVSHDLSVMNKLTLARWANLAGIPFWLNDRLGTLTESNLELVVTVLWLNA
FVPTFIRLLDIRGRWSRSVLAKKEVLQAAMDSHLEGSRFHLSDRYTDTTKTVFACLAYAPVLPIAMWIGLLSLSLSYWSD
KWLFVKAWRTPQPPGNSGRVARLARRHLALAVLAHCVFALYYYAGWPFDRICRFDQGWIECSQEGTGLIEAETQSWMTGP
QKTLVDVFSALNVAWLVILLVFYYLQSIMRGISLVVKGAPRKLRSRQHMPFSQLTSRYQHDVDAYVPQIKSSHQPLPLLA
CDLDFVEPETIPWQVDGHKGDSFEDYCLSSSRDMPRTSRYQRARLFSLCVHYPPPAPFEAIGNGC