TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D7MYY4|D7MYY4_9NEIS Putative uncharacterized protein OS=Neisseria sp. oral taxon 014 str. F0314 GN=HMPREF9016_00025 PE=4 SV=1
MKKTALAFLISAFAASTASAVTLVDSQNSGTKVEFVGSARIKLTNTADKETDVKEGSVTKNQTNRPIQNNGTRFGFKLKQ
SLGNDFYGLGRVEWRFRGKDNAGNDARSNHNFDHLYTRQLYAGVGHKRFGELTYGNQSVITDDVKQTDLANTLSLSDGLL
ASSVRRSVQYVYDNKDQGIKAGVFYGGSSPRGNDGLSLDNKRKDIWGVGAVKKFTIDDKQEFIVGTGTSRERFRQSEPSD
YSRTAYSIGSAYTYDKTTVGLDLERSITKDEEGAGNKETNNEIRTILYHKLTSDWRAYGMYAYKTEKQDYVSGSDKKEKQ
HQFMLGTEYYLIPKSKPFNMKTFVEVQNTHTKKYRRDELRTKERNYTTVVGLRAYW