TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D8CZZ3|D8CZZ3_COMTE Putative uncharacterized protein OS=Comamonas testosteroni S44 GN=CTS44_00459 PE=4 SV=1
MSNESKVQALIETAKAAPAVAGAAASTMTLNHWVAIATGVYIVIQALYLLRKWWREERGKGGWLNEEGEAT