TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D8LH97|D8LH97_ECTSI Ankyrin Repeat Transient Receptor Potential Channel OS=Ectocarpus siliculosus GN=Esi_0019_0113 PE=4 SV=1
MARCTLICAALDKATSDADMADAAMPEVHQQSWTPHRAQNLLGEDLESVLDGALQSKAPEDGQNLLTYAAAQGRDAWFLF
IAGKIRSKMGVRALAKELRELDIDRAPLLFNAAASRGEKSCFRTAHDLVYKALGKGGLLEQLGAVDGEGRTMLMHAARSN
NSDAYDEIVGIYFKVVPLTSSGYTEKDHKGMNCLHHAAEAGCSEVLGKVIKKYSDAGGSSYAERDNNNRTPVMCVLSDAS
REERADDSLRDKFTLLYSNMSTTCGEQDEKVCTHDGGHAKQGWMEMTDVPTQQISRSEEISKARGVTELMHAARGGLVSL
ELALNEPLPSSRLEDGSISLDGALNVEACDEPASDEPRWEPQPAWGKGLLLAAAAERGDIDVLHVVLTAIKDNKFTKEPN
TDRFTLRKQESRLAELPYGDGEKVRTVVREMSKGGKSLFSEAILSGQTVAVKHVYRLIVKLFGKTHPETWAILTGRDFNS
GKVAEASPLACAASASMEPCDHGRDTFDLVYSYLQTHAPDEKKLRIQLVPQPPPLDLTAKTQISPLVGAAFSSNWILFWR
VYDTYTTLAKKPWLRTNALRRATSDKSGGEELMSWREYLRAYSSRAVHVASERGAFTDLRDLVKEGFPLHDDHIPALLVS
IGDHEQDIIETVLFAVANASNPFGMAAGVSRFLRRARVDHPMHQRGLRRLQTRIDRFTLEQWMLEPSLLVEKINKAKKYR
GPVYKDPLQSALDRGSDALEFLFSPLVLDYVHVKFAGTLPHWSSRNPFQPTINEGLYKYDNFEVYDLAKLLRGSKNDQAT
GRTAPSGASSASTGSTNRGSFLWRSPGSIMSFLLRFLQGWDHPRSNDQSVWSIPHLTILPGLQFSLAGILGKPETFFKVP
VIRFVYEIFSYLVMLVLFCSSVLLKEPDFIPRDEVIFYIFAAGLLWREVLEFLDGVPTRRHRTSGGPRTEEGGRVEPGIS
HLGAGSNFNRMVSAFTRYVFYDTWNFMDTSTICCIFVAFIFRMIARFDSEFDLFYAQFFYALSAPLLFSRLLVLSQIDAT
LGPMTQVIWRMMSHMLRFSAFIAMVMLSFALAFHAVFHTCGEHSEPQCTLDDDDAFPLRDAFGTFGDSLLTVFSSALGGP
EFDLFDDAGSDCRCNLPRGARSAGISMMVVYTITMSVVLLNLLIAVLSTAHDEVYVNAEKEFHLARARLVVQSARSVAHR
RPPPPLNLVKLGFGVLIDVFTEIWRFILWARSLRSRCLDW