TCDB is operated by the Saier Lab Bioinformatics Group
>tr|D8LH99|D8LH99_ECTSI Ankyrin Repeat Transient Receptor Potential Channel OS=Ectocarpus siliculosus GN=Esi_0019_0117 PE=4 SV=1
MYHLRRHIRNPEMGVEKGWKLVKDELGENLESILDEALLSKCPEDGQNLLMYAAAHGNEEWFLHLIDHIRSQLGIPALVT
ELREIDIDGCPLLFHAASSNCKYSCFRTAKYIILSVLGKGELVQQFELVDGLGRGILMHAARSNHVDNFKEVFNRCREVA
DRMRPHDEPTVGGQTESLDPQLPATDTASADIGLLREVLGKADRIGKNCLHHAAEAGSYAVLHEVVKLCCSVYEEMNTAD
IMGRTPIMYVLRNDSCRGQEQQGSTLALKEESLRKKFHELYEALQDATCPQDTPVKTGWMEPSRVPPPSLAVPKGTRVDT
RAVTELMHAARGGLVSLELALNKLPLASRNIAEGGFTVALDNALAVNMTIGNTQEQSHRTKAWGWALLLAAAAKLGDIDV
LYHVLLAIKKGKFTLVKHGENDHDFRLAKVERPAGGGWVELPRGDRVQEAVRAINTRGKSVFSYAILSGRTDAMELVYDL
VRGLFGDKTSQTWDTLSGKTNKSSSLTCAASASMEADNHGITMFDKVFSLLQQQTDDRLLVQRQLSPRFAMPHRGKGKVK
ISPLVGAAFSSNWILFRKVYDTYEEWTGHRWWRQQVLAQIPSGPPRRRSVLELQEMHDCEDDIPALIIRGAWSIPAVMWR
DIVKAYQRAQLCSPDATSRGVPQPLRINPLPSWRDEFKGYSRRAVKEAAKRGTFRSLRDLVQEGFPLHEHHIPALLENIG
DHEKDIIETILATVTNASNPFAMGAGLSRTLRTSEVDHPMHQLGLRRLQSIIDDFTMELLDKLPRTVRGMGMELIGGHQP
ITFGEGFHQGKHHRLGNLAGFIAVQWFLEPRVLLGDVAVENRYKEPDYIDPLRRALDRGSKGLYKYDDFETYKLSEILST
PVKPPTANQEGEQSPAQKEGFISMTFLLRLLQGWDHRDPKRRCNFPSRVFRAKGQEASGAQAPQAPAPPAPVPPVQPVSA
AANAQAPASRPEPPNQWRIPHSTMLPGLQFSLAGIQGKPETFYKVPVIRFAFEIFSYLVMLVLFCFSVLLKEHDSIPWGE
VTFYVFAAGLLWREILEFRDGMPARRHKPPKRQVSKNDGSTRTGSEQPLSFPRISRLGTGNRFNRMVSAFTRYVFYDTWN
FLDTSTIGCILVAFIFRMIALDDKFFLFHAQFFYALSAPLLFSRLLVLSQIDATLGPMTQVIWRMMSHTLRFSAFIAMVM
LSFALAFHAVFHTCGEYSEPQCTLDDDDAFPLRDAFGTFGDSFVTVFTYALGGPDFEAFQLAGSDCRCDLPEGARNAGIF
LLVVYMITMTVVLLNLLIAVLSTTHGKVYANAEKEFHHARARLIYQSARVVSRSRPPPPLNLIKLVCGILLDAGTEVWRV
GVWVTRGRSQARMLKPFSTTHQWKTLEGGLQRLEFAFTFGVAAVGLSTILWIVSVPWVAWCLHRLVHKAEEETEAEAEAN
EPDDDGSSTSERDDGDDHDDDGDDVDDDKEKPHLGYFRRFLSGIKSMCSLLVAMVAASFLCLLYIFATMILWAVGIWMVV
TWVYSNWDKKNGDMPEPMPGQEDGHHWKRAWELASLRNQGARANRGQAHFHIAPLLKSKTGLDMQHLAQLTKNRHDESNS
EAKLIEVDQKLPYFAIDLGHLQKLAKEKTEKKRTSDPATTMTRDNRVVGGAPTRGEGGSPGYSDVKAVGSGSGGAEGGIG
DDASNTGSGGIKGGGDDGDGGATGETPSSTAPAPASAANAAPSS