TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E1FS21|E1FS21_LOALO DC2 protein OS=Loa loa GN=LOAG_03698 PE=4 SV=2
MSDGAGDFRKYENNKIVKGAMESVLEAFLFTFIDPPNVKISPPRWLKMPSPMQVFTLVMMTYFFVTGGVIYDIINEPPSI
GQTTDERGNAKPVAIMQYRVNGQYIMEGLAASFMFSLGGLGFIILDKCNNPLTPKLDRIMMLGLGFACVLIGFFATRLFM
KIKMPSYLQGITG