TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E1IBA4|E1IBA4_9CHLR ABC transporter related protein OS=Oscillochloris trichoides DG-6 GN=OSCT_0605 PE=3 SV=1
MIEASQLSKQFGAFQAVRSINLNIQPGELLALLGPNGAGKTTTVRMLGAILKPSSGYARICGHDVVQEAETVRSKVGLLT
EYPGLYGRMAAMEYLDFFGSLLGLEAHTRQARAELLLRQFGMWEARERKLDGYSKGMKQKIALVRALIHDPPVLFLDEPT
TAMDPQSARTVRDAIHDLRAADRSILLTTHNLSEAEVLADRIAIIRSGQIIAQGTIAELTRQLLGAPIYELRLAPPFPAS
AAAPILADLISVESQSDTALRYRTSEPHLLNPQILSRLASTGLPVLALAEVPQRLEEVYLRIVAD