TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E1WEV0|E1WEV0_SALTS Hypothetical type-I secretion protein OS=Salmonella typhimurium (strain SL1344) GN=siiD PE=4 SV=1
MNRRQSDHLMMIIISLTILIIILTYFIEINSVVHGQGVITTKDNAQLISLSKGGTIQDIYVAEGDTVKKGELLAKVVNLD
LQKEYQRYRTQKGYLDKDVNEISFILDKENESGLITLDGTRSLSNKEVKANIELVHSQIRAKELKKTSLDSEISGLQEKL
SSKEKELALLAEEINILSPLVKKGISPYTNFLNKKQAYIKVKSEINDIESSITLKKDDIELVVNDIEALNNELRLSLSKI
ISKNLQELEVVNSTLKVIEKQINEEDIYSPVDGVIYKINKSATTHGGVIQAADLLFEIKPKVRTMLADVKILPKYRDQIY
VDEAVKLDVQSIIQPKIKSYNATIDNISPDSYEENTGGTIQRYYKVIIAFDVNEDDLRWLKPGMTVDASVITGKHSIMEY
LLSPLMKGVDKAFSEPVNTKRLDTP