TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E1ZTI3|E1ZTI3_CHLVA Putative uncharacterized protein OS=Chlorella variabilis GN=CHLNCDRAFT_141748 PE=4 SV=1
MAFLATARTTVDRIYVWSNRQPWLFIRRGLWVLTFGWALCVLYLLFAAVMLVSIIFAPFSYQAFRMALLALDGGIILEPF
SQYIVLSLEVRLVAGAPAWGNPAHPYTICANGVWCVLFGWQMALAHLTAALFQALTVIGLGTALTNVQLAQFAIWPFGRS
LRRRQLPTSLTELEAQRANASMESSTARALGWV