TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E2JEY3|E2JEY3_LEGPN Legiobactin utilization protein OS=Legionella pneumophila 130b GN=lbtU PE=4 SV=1
MLYIRNYIRTRIILGILMLNVTGLAFADAGDSLFKNEKLTYDGHLFFNAANSTIQGEKYLLNQQLSNIKMGSELQVTDWN
KMKGLLIYNTLPTPVAPQFYFEQFYDELQIESSNIFLAFGKKWLTFGNYKSDLIYKPLTKALGQTNEVAAIIGYDSIYYA
NASFFKPYSRISTSSLPLYYNLNTGVHNQSMDTGVSYLYSLAESQLFQYNKGFGGLLSQSLKTRVPGFATYFNLKYKKTS
TYLTYVTAITPFALEDMSYNNRRASPKALSIQNSYDVNIKNFSFKITGFYDYTFQALALGIPKQRLGLGLSATPFPYLGI
QFQYSRDYSYGNTAIASGINHFVNGRNTKMNNLAFQTILNF