TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E2YHZ7|E2YHZ7_ENTFL ABC transporter, ATP-binding protein OS=Enterococcus faecalis DAPTO 512 GN=HMPREF9492_00064 PE=4 SV=1
MKHAFSSMKRIGRYIKPYRVTFYLVILFTILTVAFNAALPYLTGLPTTEISRNIAAGESINFDYVIQCLIWILVVGTGYC
VAQFLSGFLMTNVVQQSMRDLRRDIEEKINRLPVSYFDKNQQGNILSRVTNDVDAVSNAMQQSFINIVSAVLGIVMAVVM
MFLINPLMAIFSVIMIPLSLIISRTIVKISQKYFQGMQNSLGDLNGYVQENMTGFSVLKLYGREKETLEGFKQVNHRLNG
FGFKASFISGLMLPLVQMTAYGTYIGVAVLGSYYVVAGVIVVGQLQAFIQYIWQISQPMGNITQLSAALQSASASTMRIF
EILDEPEEELNEQDVPLPEPILGSVEFENVSFSYDPEKPLIRNLNFKVDAGQMVAIVGPTGAGKTTLINLLMRFYDVTEG
AIKIDGIDTKKMNRSDVRSVFGMVLQDAWLYKGTIADNIRFGKLDATDYEVVDAAKTANVDHFIRTMPDGYEMEINSEGD
NVSLGQKQLLTIARAVISDPKILILDEATSSVDTRLEALIQKAMDRVMEGRTSFVIAHRLSTIREADLILVMKQGEIIEK
GTHHELLEQGGFYEKLYNSQFAEEGDYEE