TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E4TL47|E4TL47_MARTH Uncharacterized protein OS=Marivirga tractuosa (strain ATCC 23168 / DSM 4126 / NBRC 15989 / NCIMB 1408 / VKM B-1430 / H-43) GN=Ftrac_3350 PE=4 SV=1
MESKEEFIHQGSSFFGRHQNYLSEFVYGGIDGSITTFAVVAGAVGAGLDNSVIIILGFANLFADGFSMSIGAYMSAKSEK
QHFEKQKAIEYWEVDNMPDTEKEEIRDIYIEKGFEEPLLSQVVEVITKDKDRWVDVMMKDELGLVEEEKSPFQTGLFTFI
SFLIIGLIPLLVFVADYINIEITNKFFWASILTGAAFVIIGFLKSRVTNNSIIKGISETLLLGGLAAVVAYFVGDFLEQI
IR