TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E5Y3Y1|E5Y3Y1_BILWA Putative uncharacterized protein OS=Bilophila wadsworthia 3_1_6 GN=HMPREF0179_00892 PE=4 SV=1
MLKQLLLALKRLLRALGPVLVGCIFLGAVYLLYREISKYSLADIRMSLAQISTGSIILSVLLAIINYIILIGYDWLALKG
IHKTLPVSRVSLVSFVGQAVSYNFGALLGGSTVRFRFYSSWGFSPMDIVRLVLMLAITFWVGALGLVGAIFMIAPPEIPP
ELGMHMPLDIRPLGAILFLIAISYLIVCKFIHKPIHIFGKEFAFPPFKIAVAQAVVAGADLVAAGACLYVLLPPDAHVSF
LQFLPTYLMAMVAVVLTHVPGGAGVLEVVILHLTTASPQAVFAALLCFRVIYYLLPLLLAAVIFAIYEVRQQAIQESGVL
HDAGRWMRAFAPTIMASAVFGIGAILCFYVVLPVSPERLAQIREWIPLGIVEFASMATGVAGVMLLFLTRGIQHRQRAAF
RLAIAMLCIGIIGPLLHSLSWFVALMSLIVLLSVLSIRRKCCRPSSLWKLHLTPSWLFAIVSVLVCSAGLGLLIYHMDPS
DPVLWTSSDYAADAARLFRTFAAEALLLICIAVGYMRTAPIRKRWNAVRRFGRRNKQ