TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E6N374|E6N374_9ARCH ABC transport system ATP-binding protein OS=Candidatus Caldiarchaeum subterraneum OX=311458 GN=CSUB_C1395 PE=4 SV=1
MSGDYVLVVENLKKVYRNNGIETVALNGVDFKVRRGEMVAIVGPSGSGKSTLLNMLGALDRPTEGRVIIDGVDISHADDD
KRALIRNKLIGFVFQSYNLINRLTAIKNVEMPLAIQNVPEQERRKLALEMLKEVGLESKAYKKPTQLSGGEQQRVAIARA
LVTKPSIILADEPTGNLDSKSGAIVVQLLKNLAQKGHTVIVVTHNMEVAREADRIIYIRDGKIEKEEINTVTVQQA