TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E6NBB1|E6NBB1_9ARCH Uncharacterized protein OS=Candidatus Caldiarchaeum subterraneum OX=311458 GN=CSUB_C1392 PE=4 SV=1
MKPGDYIKYAWSALKDRRLRTTLTVLGIVVGPALITALNATTAGLTQSIVSNLEVFGTDLVLVQRVGDFNFDDNVVNYIS
SLQGVKETYPYYLIASGEIKTRGKTFPMDPTKSYTVLAVELRDLPKLFPNIKVDSGAIVDNPSAAVVGYNAWNPRDPDLP
PIDVGSIFTVTPLSGTGTTRSFTVTARLGKYGQSLFLNPDNQIFVSPEAGRLITNRRSYSGVFVKLTDPGYSDQVVLAIE
QKYGGDVRVFSITAIAATVQQIIGTLNVFFSTVASMSLLVAFLGIMTTMFTSVTERVREIGLIKALGFRTRDVLLSFLSE
AVIIGILGGVFGTAVGVVAAFALSGIFSGPPADTRPGSFVTGPAGEGPRITPLISPELILMGVAVAVGVSVLAGMLPAYR
ASRFEPVEALRRE