TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E6SIR7|E6SIR7_THEM7 ABC transporter related protein OS=Thermaerobacter marianensis (strain ATCC 700841 / DSM 12885 / JCM 10246 / 7p75a) GN=Tmar_1926 PE=4 SV=1
MDPTATTAATPTAATPGGIELEHVGKSFDGGNTWVVRDLTWRVEPGRITGLLGPNGAGKTTTLRMIAGILPPDRGTIRVG
GVDVTRQPLDAKRRIGLVPDAPALYDRMTGAEFLRFLADVYGVPTAHRTRRMEELGRRLGIGDWVHSPIARYSLGLRQRL
LLVGSLLHDPPVWILDEPIVGLDPEAARALKDLMVERSRRGGTVLMTTHLLEVAERLCDVVAIMHRGRLIAEGSPADLRR
RFVREGGEEPAARPAAAGLPADAGLEDVFLLLTREPAPGGTDEPGPGRHAPGGSR