TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E6YJ42|E6YJ42_BARC7 Putative membrane protein OS=Bartonella clarridgeiae (strain CIP 104772 / 73) GN=BARCL_1208 PE=4 SV=1
MSQKACSSCTTQEIVAHATQLKKDHAALYLKYAKALESSCPNQALILATMSHNELQHHKQLLDLSCHMNSGTLHSSLDNF
PFSSFSPTSASSHSSEETDQSILTPHQKKTLLTWIQPGLAGLMDGSISTLAPIFAAAFATGDTYKTFLVGLSASIGAGFS
MGFTEALHDDGKLSGRGSPVKRGIACGLMTMLGGLGHTIPYLIDSFFLATLIAFIIVFFELGAIVWIQNKFMSTPLRRAS
LQIIFGGALVFATGIFIGTI