TCDB is operated by the Saier Lab Bioinformatics Group
>pir||E88651 protein B0212.2 [imported] - Caenorhabditis elegans
MPSLNSSKLSTFFRFTKMYLLNPGSMYKLTVMNMTTAAIEQTDAIFRAALIFEWILISIGFGETMLLWYLLRYTNQYHRN
LAMIVEQLPNQYFPSLLARMYMIYKQLTISNTADLIEDQGFLFAVWLRNSLLFVAFYFAPFPVIERCFATLYMHDYETNK
RRWISYLLSTILYIFAITSAQFFIFGSSNREIHIFLITGFNLIAFGLTFVMERYNKKRYSKLRKNVNSDYSLSVRAQLSE
NINSTLPFKVMCFSIAFFASLCTSMLHVDEWTESQTIRNWVYMAFNFSCWSYGTLVPFFMLAYNPLWQKELRRLGGKFCC
CLCPANRIGADQTGRKRPPTKVKDTFGKNCNVEDAEHTTIYFSQLNADWNAPTEQKKRRERKNERLSISDAQAQSVITSR
SISNHSVMTRPDSIELDSICEAGDSMDDLREILSHTETTPTRTLPTRFERMASQMTCPMIGVKKLSTDKLQEIFLRQGVE
EPEEQQEPEEAMGVPTQADQLDHVRFTSGIERPVQLTRIDSNYSISENEEESENGSTLDIDKTPESAETTWLRDKKAKYV
QLIFKISKNILKVGD