TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E8QX74|E8QX74_ISOPI Uncharacterized protein OS=Isosphaera pallida (strain ATCC 43644 / DSM 9630 / IS1B) GN=Isop_0312 PE=4 SV=1
MMTKMIMTRSVSCRRHVVGWIERWGSIALIGMIGWLGGPVERALAGGVRVGETSVATLHGIDSVDFERQVLPILTTRCFE
CHDARKQTAGLRLDARSRAFAGGESGLASIVPGQPDESELILRVESQEEFERMPPKGPPLTPEEIGVLRLWIEQGATWPD
ALANDHDPARDHWAFRPPNRPALPDLKGHHRLAGWVRNPIDHFVAARLAAEGLEPSPAADRLTLARRIALDLTGLPPSIE
QADALAHDPDPDDQALARYIESHLRSPHYGEHWARWWLDAARYADSDGFEKDKPRSVWNYRDYVINAFNANLPYDRFVIE
QLAGDWLPNATPAQKIATGFLRNSMINEEGGVDPEQFRMEAMFDRMDAVGKSLLGLTIQCAQCHDHKYDPLKQSEYYQMF
AFLNNDHEASIEVFTPEQESRREEILSRVRAIEAELKASAPDWRERLAAWEAALLDPSQAFSWSVIRPEAEANSTGGQKY
LLQEDGSFLCQGYAPTKHTVMLTAQVDRPVLTAFRLEALPHPDLPLNGPGRSIKGTFALTEFKAEVTPLGVPNAKPTPVE
FVRATATVNPPERELDPIFFDKTDRRRVTGPVEFAIDGRDQTAWSDNLGPGRRNRPVEAVFLAKRPLVDPGGRGFLVTIR
LVQNHGGWNSDDNQNHNLGRFRLSVTDETTAQADPVPLDVRASLKIAPEQRTPDDLERIFAHWRTTVPQWHEANQRIDAL
LAELPEGTPQLVLQARAQPRTTQILKRGDFLKPGDPVQPGTPAFLHPLETTEGTPLNRLTFARWVVDRRSPTTARAIVNR
VWQRLFGVGLVETPEDLGVQSPPPSHPELLDWLAVELMESGWDLNHLQRLILTSATYRQSSRLTPQLAERDPNNRLLARM
PRLRLEAEVIRDAALAASGLLNRRVGGPSVFPPLPEFLLQPPVSYGPKSWPVSPPEEQRRRSLYIFRYRSLPYPALEVFD
APPGEVACVRRSRSNTPLQALTSLNEPVFVEAARSLALATLKQAAPNETDRLTHAFRRVLTRYPVPEELAILGALRRAEH
ERLAAQKDPQATAWTLLAGPEAANHPERRPDLPNQVDPIEAASWVAVARALLNLDEAIVRE