TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E8T6H5|E8T6H5_THEA1 Sporulation domain-containing protein OS=Thermovibrio ammonificans (strain DSM 15698 / JCM 12110 / HB-1) PE=4 SV=1
MRKFINIAALFLLLPATAFGLEEDEYYCIQVASSPGNLDLLIEEAKELQNQFPQVRVEKIGHMYTVRVGFWKDFKKAKSA
LSEVKQLFPSAFLRDCYYKPQRWVFPARTETEKRANKIETRETATEKGIPEKPGKPSTSPLSFKWEEEFEKVKSQIKVTE
PKLPQPLKQPTEEEKRAETASSKTTTFIGETYLFVDGSFVEGLDPRTGCRKRGRELIGRLGYRFVTDLFNSFSVWGDIYG
GIGYQRFRHTTRRKGWWDIRYLYLNTKTFEERNTPGYDLSLGRMPLLEPRGFWYRNYLDGLRLRYQSTLLNWYLFAGGRF
SDSRVSSSEERINLQGYRYLVARADYQYYYRQHLGFFFIKEYKKRFSNLNDPSVWKGVRPKENLNWLGVRLKGEKEWGSY
WLDLGYMWGKRGFTDSIEQDCTAYKVVTATYYKGVHGIGAEIGAKRLLGDERNKGVGFRFAVGQGSNSRTGSTNFYLPKI
STSMSYLFGPNRIRYYGELANPDLNNLVLLSLFGGYKVGEDTWLEANLIKYLQYKISPYAPFSRYFIAPNGKSRDLGTEL
DLLIDGEITGNGRWRYVAAGTLFIPGGAYSGKLDQWNAYGVFLRIKRYW