TCDB is operated by the Saier Lab Bioinformatics Group
>tr|E9CBF5|E9CBF5_CAPO3 Uncharacterized protein OS=Capsaspora owczarzaki (strain ATCC 30864) GN=CAOG_05499 PE=4 SV=1
MQSEDYAQSRSQLPPVYQPYPPPPAQAQAQAQTQPNHQHYQQQAQSQAQASSAAASGTSQPPNIRPRLETARSNADRLRV
RQPDGKAYNLRVPPQQLLSLGVGVPLFFEFLWFCIVLGTCVTLFYSIPMVVLNIQGSWADIDHGLGGGTWNIRNCSNTSN
PVSLVTSSFSPAASNYHLVDSDSTSTNETELEAAYNWFLGHRSLAPGAGYVVIELVMLIMVLKLVVVWRRRISVRATVFA
REMLTARHYTVMVSGLERNCTNTEELAQHFAQWGPIAHVSISLDSMRVMHLMQKHKEMSVELGSALAREAAQRNGTSDPV
AQSGLLSQILCAFRSLTHRESRQVREELAAIDAKIEELKHRRVFHCTGYAFVTFRSADSALCCLIDHMQKPIWVRFKDWV
ATSWLFRAYSPAAPSASALASSSSSSAHNEASLASKAPLLTRGSSSSLSGGPYANMHEGLMSPPSSNARTSADRSSAAYA
LPTANIFGFKPSRFVFRSTLRPKLEAPPEPSDIIWENLHITLFQRLLRNSVTSLLCGIVVLAGFASVTSLLYFELTDDHK
SHVDLGGVGSKVINALVVTFVNWVLATVVTALGRWERHHTYSGFQNTALAKLLLAGYVNSGYSILAAYLIVSEWGTHNSR
RQFGSIFWYSSSGQLSAALTAIISNAVFNSLIQFVMPVTRMREFLATRTALTQTELDKRMAPREIMFAARYVNAIVNMSV
AMLYAFQMPLAPLIAVFAVGLQYWVDKRNLLRIHKRPPRIDHRLSLRALQYIPWCIYFHVVLGGLAFVLGPWCGNGDDLR
LILPQLGEISFTWAWIWLMSGIGLLAGIIRYVPWKRFFRWITCSCCGLASGRGGSGDSYANDMTGLSGRTMRRSRASWPS
SRDSEPLLQTQPPSVSRAYLVPALSPYESSATEADHATNRGGQGPLLAQDVLADPSVTPSLKQLVSDAVIRPPYEVIVGS
LEEEYRPPIAVDDVVLRETRTTLEMYYELLRGKSQTLVQAFSGRTADTVLSSPRRLTVDRIAAAFSPSVAATSSSVNLNT
SSISTTSSVSGGSSYINVSSGSGGASLVSHVPSSPHSLTPRHRRSGSISSVSSTVSGVSNVSNIPSQSSSIAAMIAAANG
LEDEEQQQDQMLRSTTSWSKGVLPRDESRM