TCDB is operated by the Saier Lab Bioinformatics Group
>ECY3018204.1 hypothetical protein AT630_13190 [Salmonella enterica subsp. enterica serovar Montevideo]
MADKVTTAAAYTTSGATFLAGSMSLNEWLALGGFVLAVFTFAINLHYQRKRDRREENALRMQHGDQRNESNNHPA