TCDB is operated by the Saier Lab Bioinformatics Group
>EEQ47301.1 conserved hypothetical protein [Candida albicans WO-1]
MPELDLEENNPLLPPSQINDENYEGSIFGEDARFCPNSRQVFRICSNLKLLIDKIIPICFKEDEITSSNSAILSDPVIDL
VYQAAGGKGDGKEGTSSYKYRGSLVFCLLKVCDWYWQQAEFELSDNELYSLRALTAQTIAAIIIEREKRDKYLFLNMLCH
RYTICVNGVDATPVSALEMAVDMHSTIVIGSSGYQRCIKWLWRGWIIQSSTDPHSYVLYKGAASQSFRTHFDPARIKTPL
YQNILEIFLSIIYLIIFTIVVNTHSTLTGDIDFFETVLYLFTVGYILDEFIKFYHVGWNYLGFWNAFNDPMYCILTVAMC
FRIASVNSHGATRIKYDEISFRVLACASPLMWSRLLLFLDAYKFVGAMIVVLKTMMKESILFFFLLFVVIVGFLQGFIGL
DSSDGKNEATQRILISLVKAVIGGSSFEDMGNLVPPYASVLYYFYQFMLTVILMNILIALYSTAYAAIVENATDEYFALV
AHKTLRYIRAPDQNLYVPPFNLIELLITPIGWFVSTSTWKNINYYVMLVIYSPLLAYITSDELSNARRIQYNRFKGVPDD
ANEIDTEWDLTDGYDEDSPGDGDDCWDRIRERNSEITEELRIQREGERQDPEFMINTHQFSEKIDKIVKPVGQASKVGVN
WQIYEVIEKIDKLTNLLEVLLSKIKIEKKLEISLELSF