TCDB is operated by the Saier Lab Bioinformatics Group
>EGU43430.1 outer membrane protein OmpT [Vibrio ichthyoenteri ATCC 700023]
MNKRIVSLSSILLISTPSLSYEMINNDIAYLDFYGDVKASAIFLDGQDNEYSFGDSKIGVRGRYAVTDLISIAAGTEAQV
NLDADEDKNEDDLFISQYFVGLYAESLGALTYGKHSTSSDDLSGVDYSEVFGGKSNLNSVGVKGDTIKYVYDNELFTLNG
TYGFESGEQKRTLTEFFGQYNLADLILVSGIGSTETNATSNKTDALYFHTTARLEMGDTNLGITYYHQNFNNDSQPSRSV
DKNAFAIAGQIAFTVALTGYAGHEVINQDSDNSAITGTRNNSYLGLSLVPLEYTKLFAEVNFDSPIQAPDETNFALGAAI
AW