TCDB is operated by the Saier Lab Bioinformatics Group
>ERJ13314.1 Potassium channel putative protein [Haloplasma contractile SSD-17B]
MEKYEIKGFDRSKVFVGIAGIALIVYVYFEIILKDSQDQNVKLLFYIISLSLLYWLIFNLFNSLLWKLKIFNIPNLNGKW
KGKIISSYSDQSTKTEKECTITIKQTFTKIKIKLQTDTSMSCNVNGFLDITKVDSFQLSYEYENQANGNSTETMNDHKGY
CIVDFEPEDNSIIGFGNYFNDIKNRKSFGYIEKIRPFEEKTFNKNFNVNEELNVKKIFSFVTWFLLIFSIINYFYNNCDV
IPLIFEGLLSITFSTIIVNLSPLKMIKTIFKETLSLLSNNIKEKFTKQNNSISTIKNYAIGLYTIAYIIGILSFNGLFIY
VAFNNLNSENSLPFVYSSIMLGLLIINTFLVTLSWFVFVLPNKLENKLGSRGAIPIVISLLLILLSSFSIIKNPDNTYYD
LMLYSLVIGFIILFLGNIIFLFKDINIFLYRNKNKQISIIKYFLFMFIYIIFYATYVTYILHKFDASALSTVNSEISTID
YFYYTVITITTVGYGDVTLNTFMGKIWSMILSLQGFIYFALLLGILSSYIMNNASDNDQKKE