TCDB is operated by the Saier Lab Bioinformatics Group
>EYB80988.1 hypothetical protein Y032_0395g648 [Ancylostoma ceylanicum]
MSEEESHCSEAAAFIAFIPQSVSMSTHILLCFVALVTNCIFVQFSSKQLNFHFNCRILILTLVSINCAHSTVYSSLLVRY
EVYHLIKIHSIHENLCDVMTDGRFCFPMRLTTSACYIGHTTVFFGLLLERCLATRYMATYERSSHRAGYTIACCSVLSAF
LLSWFKIRLFNMGQRTVYCSSVTAETYTDVLITHSLLLMLLTITVIIFGFIFLQNRRVTKRVARNVSEKYQATENIRALR
MLAPLLIFHFICYPLYFTVSIITQSIRHLVGTLYFRVIFSAVYCPSYYCVLSPLILLYIIRKKASTNEKTIFTVTTGKPQ
REEDIYFQNYRTMW