TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F0BFS6|F0BFS6_9XANT Integral membrane protein DUF6 OS=Xanthomonas vesicatoria ATCC 35937 GN=XVE_3090 PE=4 SV=1
MRERLTMGVACGIGAGALWGLVFLAPQLLSAFTPLQLAVARYLSYGAVAALVLAPRARQTAARLGRAEWWALVRLSLMGN
LIYYVLLGSAVQWAGSAATALIIGLLPVVVTIIGTRAAGAVQLRRLAAPCVLCVIGVALVALDTVQDDSGQQASDRLTRI
AGLLCAVGALVSWSAYSIANARWLRRRPDLSGGDWSLLTGVVTGALAALLAPAALIGGAAHAAIDWASFWGVSLLLGVLA
SVIGNALWNRASRVLPLTLVGQMIVFETVFALLYGFAWEMRLPTPLELAAIACLLVGVLWCAALHAEAN