TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F0JDW0|F0JDW0_DESDE Uncharacterized protein family UPF0324 OS=Desulfovibrio desulfuricans ND132 GN=DND132_0182 PE=3 SV=1
MAEKRWLTEDKLALIMGLILFGLGMFSFAGVDLLGWGVSTNTWITPGQIFSVTAKADYGGLNGYASLFLTYAFITLFLSF
GVKFLGGDVPKFVKSFTVVFFLSIICWALGHYAVIAATPDKLEKFGLTWAMGLTGEAGFIVALVVGIVIGNFFPGFAEEM
KEALRPEMYIKIAIVILGAELGVKAVDAMGLASAVIFRGLCAIVEAYLIYWALVYYVSRKYFKFSKEWSAPLASGISICG
VSAAIATGGSIRARPIVPIMVSSLVVVFTCIEMLVLPFVAQWWLSGEPMVAGAWMGLAVKSDGGAVASGAITDALIRAKV
LADTGVQYQAGWITMATTTIKIFIDVFIGIWAFVLAAVWCTFIECKPGQGGMKIGEVLDRFPRFVVGYVVTFLVMLLICA
TNKDLIPLGKATIAGTHVFRGLFFVLTFFTIGMVSNFKKLWAEGIGKLAAVYIVCLGGFIIWIGLFISWLFFHGVKPPVA