TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F0SI03|F0SI03_PLABD Uncharacterized protein OS=Planctomyces brasiliensis (strain ATCC 49424 / DSM 5305 / JCM 21570 / NBRC 103401 / IFAM 1448) GN=Plabr_3089 PE=4 SV=1
MNLSFIGRIFVFHFAIAACLACSQSMADQQKTLAGQSKVDFAHEILPILTKHCIECHAGANRSGGLSLGTRAALLSGAES
GAVVVSGDAGASRLIEVVESTEEYEQMPPEGPRLKPEEIAALRRWIDQDLPWDAGVTLGEAEWTPPLQPRMVELPSAWRG
REHPVDRLLDAGIVSREQTPPSPASDAAFLRRVTLDAIGLLPTPEELAEFTVDPSENKREQKIDELLARDVAYADHWLTM
WNDLLRNDYTGTGYITGGRKQITPWLYASLKNNKPYDEFVRELIAPTAESSGFIDGIQWRGDVNASQTREIQFAQNISQV
FLGINMKCASCHDSFIDRWTLSEAYNLAAIYADSPLELNRCDKPTGQMATPRWIFPELGDVDPEASKQERLQQLAGLMTH
PDNGRFTRTIVNRIWERLMGRGIVHPVDAMNSQPWNEDLLDYLAVRFAKDGYDLRKFIRFVMTSQAYQSESVVQLHEPDE
SYVYAGPIARRMTAEQLIDAVWQVTHTQPVESEADVDRSREVPAQVSQQENTYSTPVVASWIWHGGETGKQTFLRKTVTL
DSAPFAARLIATCDNAFKLRINGVEVASSRNWKQPQYVDVTSHLVKGDNLIEVDAEMFGGSAGFVGQIALQNEAGLQVIA
SDESWDARASADSGWASAAVLKPHGAAPWGNVLKTGVSSAPPVRAALVKNDFLMRSLGRPHRDQVVTSRPSGLTTLQAID
LSNGEILAEYLERGGKRLASNGLSGERLAERLFLYALSRKPVEAEWQVVKDVLAGRNDAQAVEDLLWIIFMHPEFQMIR