TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F0XY52|F0XY52_AURAN Putative uncharacterized protein OS=Aureococcus anophagefferens GN=AURANDRAFT_36185 PE=4 SV=1
MEVAVARACGREPRPCRGRRRQRVFRSRGLLCVMGGFLAVALAIDLSTLARGPRIGPGRSLRAAAGSDGGDARARDPPAG
AGAARAPPAPGGADLRDGEPGPDRPRLGERSPRSLSHAKNAQQQKEKNPFWVGDAFIHKKGKGNQHGNSPLVVFHVLGVC
YMFLALMIVCDNFFGPALDCMVEKWEIDDDVAGATFMAAGGSAPELATSFMGQFVSRSDIGFGTIVGSAVFNVLFVIGMC
ALVVPGGALPLTWWPLFRDCSYYIMGLLVLAACVSDESMVWYEALILFLLYLCYVTIMAYNEPLEIFTTRQFGMEKNAKV
RPGGEDRPSIARAAAEAKKAASDGGATTVEVAASGGGAPSDAEGVEAAESPGPDAGAGVGVYSKQIYDSVPPDGPGAADK
AANGGEEAKGGEEEDEDEWEDPWAWPDDAPDRILFIVAAPLKVCLYGTLPDCAHPDKKKWFLGTFAGSLMWLVVFAYMMV
VWTTIIGSVVGIGDYIMGLTVLAAGTSIPDALSSMYMAREGRGDMAISSSIGSNVFDILVGLPVPTLTKYLVVAIIGNPL
KNASWDFSTTGIAFDTIMLLSMVALVVLSVMRNNWTLDLKLGLVMFSLYFLFLAVSITFKSIS