TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F1R8V8|F1R8V8_DANRE Uncharacterized protein OS=Danio rerio GN=slc7a7 PE=4 SV=1
MASYSPTPAEEASPEVSNGNLKASSSQESMKLKKEISLLNGVCLIVGNMIGSGIFVSPKGVLMYSGSYGLSLVVWTIGGI
FSVFGALCYAELGTTITKSGASYAYILEAFGGFLAFIRLWTSLLIIEPTSQAVIAITFSNYMVQPIFPTCIAPYVANRLL
AAACICLLTFVNCAYVKYGTRVQDFFTYVKVVALIAVIITGLVKIFQGYTQNFEGLFSDSSHDPGDVALALYSALFSYSG
WDTLNFVTEEIKNPERNLPLAIAISMPIVTVIYILTNLAYYTILPIPAILDSDAVAVTFADQVFGYLNWTIPVAVAFSCF
GGLNASIVAASRLFFVGSREGHLPDYLCMIHITRFTPIPALLFNGAMALVYLCVEDVFKLINYYSFSYWFFVGLSILGQL
YLRWKQPDRPRPLKLSLFFPIIFCLCTVFLVVVPLYSDTINSLIGIGIALSGVPVYFLCCHLPATRRPMWLRKFIASSGV
LIQKVCFCVLTEMDKEEEKTE