TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F2HJG8|F2HJG8_LACLV YlcA protein OS=Lactococcus lactis subsp. lactis (strain CV56) GN=ylcA PE=4 SV=1
MDTKKIRWFTVAFIAFNMVWGMGNVVNNFAQQGITVVTSWLLILALYFIPYALIVGQLGSTFKDSKGGVSSWVENTSTKR
LAYYAAWTYWVVHIPYLAQKPQAILIAFGWVGQGNGNLVSQMSMTAVALISLAIFLAFLWLSTKGLSTLKVIGGLAGTAM
FVMSLLFIVMAIGAPFIAKDFHIATPDMGNIKTYIPKFDFSYFTTISMLVFAVGGAEKISPYVNQTKNPAKEFPRGMFLL
AGMVGICAVLGSIAMGMIFSSGNLPNDLMANGAYAAFQILGQHFGVGNFLMIVYALTNGVGQIAALAFSIDAPLLILLAD
ADPEFVSAWLRKKTNKGTLKNGYTLTGILVSIIILLPLLGIGDMNELVKWLTNLNSVVMPMRYLWVFFAFIMLNRAVKHF
QSEYKFIKQKRLAMIAGAWCFLFTLIACVLGMVPKLDYAANPSAWWFQLASNILTPIVLILLGMLLPFIARREQRKTNGL
DLNSLNVE