TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F2HL33|F2HL33_LACLV YrfD protein OS=Lactococcus lactis subsp. lactis (strain CV56) GN=yrfD PE=4 SV=1
MENGKKKFSLFSAILSVICVVFVAEAAAPVAAIGNSQFFWWIVLIVAFLLPYGLITSELGTTYTGEGGLYDWITKAFGHR
WGARASWFYWVNFPLWMASLAVLCPDLLQTMFGFQLNTGISLLIELIFIWVIVLISLYPVSDSVWILNGGAVIKVFLALA
LGGLGVYSALTKGVANHYTLASLLPSFDLHSLSFISVIIFNLLGFEVICTFADSMENPKKQIPQSIIIGGIVIAAIYMFS
AFGIGVAIPTNKLSTSSGLVDSFQVMLGTPTGWFISLIAFLFMLTLVGNMVSWSQGVNNIASYAADNGDMPKFFSKRRAS
NGISWGAALMNGIVATFIVVIAPLLPNQDLFWSFFSLNLVLFLLSYIPVFPAFYKLRKIDPETPRPFKVSGSDGILKVYM
ALPMIIIIISLIFTAIPLQYDKASLTEQLPITIGAIIFIVIGELIIKRKLQVQVSQPSSSHMNSYS