TCDB is operated by the Saier Lab Bioinformatics Group
>tr|F2HL56|F2HL56_LACLV ArcD1 protein OS=Lactococcus lactis subsp. lactis (strain CV56) GN=arcD1 PE=4 SV=1
MDAENKKGIGLAALVAIIVSGAIGGGVFNLSNDLATNASPGGVVISWIVIGFGILMLVLSLNHLVVNKPELSGVSDYARA
GFGNMVGFISGWGYWLSAWAGNIAFAVLMMTSVDYFFPGVFQAKNGSLTILSVIVVSIVSWGLTLLVMRGVEGAAAINAI
VLVAKLIPLFVFVIAGIVTFKAGVFSAHFWQNFVANTNADGVIKSLTWSNMTGGDLFSQVKGSLMVMIWVFVGIEGAAMM
GDRAKRKSDAGKASILGLIALLVIYILLSLLPFGFMSQQELANTGQPGLVHILNAMVGGWGGSLMAIGLVISLLGAWLSW
TMLPVEATQQLSEQKLLPSWFGKLNDKGAPKNSLLLTQLIVQIFLIVTYFVADAYNVFVYLCTAVIMICYALVGLYLFKL
GIQEKKTSNIIIGFIAAAFQILALYYSGWQFVWLSLILYAVGFILYALGKKEYGTKMSTAELIATFVLTVLGILAVFGVY
GNWLGLQDALGIDGNTLLVAVVPLIVVTFIVYFVVRSDINKKEIKN